Rabbit Anti-5HT2A Receptor, CT Antibody 350535 from United States Biological | Biocompare.com

Supplier Images

Rabbit Anti-5HT2A Receptor, CT Antibody

5HT2A Receptor, Western blotting All lanes: 5HT2A Receptor at 0.5ug/ml Lane 1: Rat Brain Tissue Lysate at 50ug Lane 2: Rat Testis Tissue Lysate at 50ug Lane 3: U87 Whole Cell Lysate at 40ug Predicted bind size: 53kD Observed bind size: 53kD

Be the first to write a review!

Supplier Page from
United States Biological for
Rabbit Anti-5HT2A Receptor, CT Antibody

Product Specs
ItemRabbit Anti-5HT2A Receptor, CT Antibody
CompanyUnited States Biological
Price Pricing Info Supplier Page View Company Product Page
Catalog Number350535
Antibody TypePrimary
ReactivityHu, Rt
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
ApplicationsWB
ImmunogenSynthetic peptide corresponding to aa400-431 KENKKPLQLILVNTIPALAYKSSQLQMGQKKN of human 5HT2A Receptor at C-terminal
Target5HT2A Receptor, CT
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene Name5-hydroxytryptamine receptor 2A
NCBI Gene Aliases5-HT2A, HTR2
ClonalityPolyclonal

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!